Invitrogen™ Human ELMOD2 (aa 216-289) Control Fragment Recombinant Protein

Product Code. 30202267

Brand: Invitrogen™ RP109708

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144796 (PA5-144796. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis.

Specifications

• Accession Number: Q8IZ81
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 255520
• Name: Human ELMOD2 (aa 216-289) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9830169G11Rik; ELMO domain containing 2; ELMO domain-containing protein 2; ELMO/CED-12 domain containing 2; Elmod2
• Common Name: ELMOD2
• Gene Symbol: ELMOD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDCNVAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining