Invitrogen™ Human ELMO2 (aa 38-113) Control Fragment Recombinant Protein

Product Code. 30213331

Brand: Invitrogen™ RP92080

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82636 (PA5-82636. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants encoding the same protein.

Specifications

• Accession Number: Q96JJ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63916
• Name: Human ELMO2 (aa 38-113) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190002F24Rik; CED12; CED-12; ced-12 homolog 2; CED-12 homolog A; CED12A; Ced-12 A; Elmo2; ELMO-2; engulfment and cell motility 2; engulfment and cell motility 2, ced-12 homolog; engulfment and cell motility protein 2; FLJ11656; hCed-12 A; KIAA1834; PH domain protein CED12A; protein ced-12 homolog A; RP11-394O2.2
• Common Name: ELMO2
• Gene Symbol: ELMO2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining