Invitrogen™ Human ELK1 (aa 85-167) Control Fragment Recombinant Protein

Product Code. 30213020

Brand: Invitrogen™ RP107332

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ELK1 is a component of the ternary complex that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. ELK1 is phosphorylated by MAP kinase pathways at a cluster of S/T motifs at its C-terminus. Phosphorylation at these sites, particularly Ser383, is critical for transcriptional activation by ELK1. ELK1 appears to be a direct target of activated MAP kinase. Biochemical studies indicate that ELK1 is a good substrate for MAP kinase, the kinetics of ELK1 phosphorylation and activation correlate with MAP kinase activity, and interfering mutants of MAP kinase block ELK1 activation in vivo. ELK1 is a nuclear target for the ras-raf-MAPK signaling cascade. Alternatively spliced transcript variants encoding the same protein have been found for ELK1.

Specifications

• Accession Number: P19419
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2002
• Name: Human ELK1 (aa 85-167) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ELK 1; ELK1; Elk-1; ELK1, ETS transcription factor; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1; ETS transcription factor ELK1; ETS-like gene 1; Oncogene Elk1; tyrosine kinase (ELK1) oncogene
• Common Name: ELK1
• Gene Symbol: ELK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining