Invitrogen™ Human ELA3A (aa 56-151) Control Fragment Recombinant Protein

Product Code. 30206587

Brand: Invitrogen™ RP105608

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65016 (PA5-65016. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1.

Specifications

• Accession Number: P09093
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10136
• Name: Human ELA3A (aa 56-151) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CELA3A; chymotrypsin like elastase family member 3 A; chymotrypsin-like elastase family member 3 A; chymotrypsin-like elastase family, member 3 A; ELA3; ELA3A; elastase 1; elastase 3 A, pancreatic; elastase IIIA; Elastase-3 A; Gm13011; OTTMUSG00000009877; protease E; uncharacterized protein LOC242711
• Common Name: ELA3A
• Gene Symbol: CELA3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining