Invitrogen™ Human eIF4E3 (aa 143-195) Control Fragment Recombinant Protein

Product Code. 30205393

Brand: Invitrogen™ RP106878

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66191 (PA5-66191, PA5-140002 (PA5-140002. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.

Specifications

• Accession Number: Q8N5X7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 317649
• Name: Human eIF4E3 (aa 143-195) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300018P11Rik; AI451927; eIF4E type 3; eIF-4 E type 3; Eif4e3; eIF-4E3; eIF4E-3; eukaryotic translation initiation factor 4 E class III; eukaryotic translation initiation factor 4 E family member 3; eukaryotic translation initiation factor 4 E member 3; eukaryotic translation initiation factor 4 E type 3; eukaryotic translation initiation factor-3; wu:fc31f11; wu:fd15f11; zgc:92189; zgc:92189 protein
• Common Name: eIF4E3
• Gene Symbol: Eif4e3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining