missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human eIF3j (aa 10-47) Control Fragment Recombinant Protein

Product Code. 30209780
Change view
Click to view available options
Quantity:
100 μL
Packungsgröße:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
30209780 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30209780 Lieferant Invitrogen™ Lieferanten-Nr. RP100831

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84041 (PA5-84041. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotic initiation factor-3 (EIF3) has a molecular mass of about 600 kD and contains 13 nonidentical protein subunits, including EIF3J. EIF3 plays a central role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex (Fraser et al., 2004; Fraser et al., 2007).
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number O75822
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8669
Name Human eIF3j (aa 10-47) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810016I04Rik; 2700079K05Rik; AA409117; AA409446; C78575; eIF3 p35; eIF3 p35 {ECO:0000255; eIF-3-alpha; eIF3-alpha; eIF-3-alpha {ECO:0000255; eIF-3-alpha-A; eIF-3-alpha-B; Eif3j; eIF3j {ECO:0000255; Eif3j1; Eif3j-1; Eif3j2; Eif3j-2; eIF3j-A; eIF3j-B; eIF3-p35; EIF3S1; Eif3s1-1; Eif3s1-2; ENSMUSG00000043424; Eukaryotic translation initiation factor 3 subunit 1; eukaryotic translation initiation factor 3 subunit 1 {ECO:0000255; eukaryotic translation initiation factor 3 subunit 1-A; Eukaryotic translation initiation factor 3 subunit 1-B; eukaryotic translation initiation factor 3 subunit J; eukaryotic translation initiation factor 3 subunit J {ECO:0000255; Eukaryotic translation initiation factor 3 subunit J-A; Eukaryotic translation initiation factor 3 subunit J-B; eukaryotic translation initiation factor 3, subunit 1 (alpha, 35 kD); eukaryotic translation initiation factor 3, subunit 1 alpha; eukaryotic translation initiation factor 3, subunit 1 alpha, 35 kDa; eukaryotic translation initiation factor 3, subunit J; eukaryotic translation initiation factor 3, subunit J1; eukaryotic translation initiation factor 3, subunit J2; Gm9781; HAMAP-Rule:MF_03009}; PRO0391
Common Name eIF3j
Gene Symbol EIF3J
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.