Invitrogen™ Human eIF3h (aa 270-352) Control Fragment Recombinant Protein

Product Code. 30197069

Brand: Invitrogen™ RP93817

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54699 (PA5-54699. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

eIF3H is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.

Specifications

• Accession Number: O15372
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8667
• Name: Human eIF3h (aa 270-352) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110008A16Rik; 40 kDa; 40 kD; 9430017H16Rik; eIF-3 gamma; eIF3 p40 subunit; eIF3 p40 subunit {ECO:0000255; eIF-3-gamma; eIF3-gamma; EIF3H; eIF3h {ECO:0000255; eIF3p40; eIF3-p40; EIF3S3; eukaryotic translation initiation factor 3 subunit 3; eukaryotic translation initiation factor 3 subunit 3 {ECO:0000255; eukaryotic translation initiation factor 3 subunit 3 gamma; eukaryotic translation initiation factor 3 subunit H; eukaryotic translation initiation factor 3 subunit H {ECO:0000255; eukaryotic translation initiation factor 3 subunit H-like protein; eukaryotic translation initiation factor 3, subunit 2 (beta, 36 kD); eukaryotic translation initiation factor 3, subunit 3 (gamma); eukaryotic translation initiation factor 3, subunit 3 (gamma, 40 kD); eukaryotic translation initiation factor 3, subunit 3 gamma, 40 kDa; eukaryotic translation initiation factor 3, subunit H; eukaryotic translation initiation factor subunit H-like protein; HAMAP-Rule:MF_03007}; MGC102958
• Common Name: eIF3h
• Gene Symbol: Eif3h
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining