Invitrogen™ Human eIF3e (aa 336-445) Control Fragment Recombinant Protein

Product Code. 30195283

Brand: Invitrogen™ RP92457

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82859 (PA5-82859. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Required for nonsense-mediated mRNA decay (NMD); may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

Specifications

• Accession Number: P60228
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3646
• Name: Human eIF3e (aa 336-445) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 48 kDa; eIF-3 p48; eIF3e; eIF3-p46; EIF3-P48; EIF3S6; eukaryotic translation initiation factor 3 subunit 6; Eukaryotic translation initiation factor 3 subunit E; eukaryotic translation initiation factor 3 subunit E isoform 2 transcript; eukaryotic translation initiation factor 3 subunit E-like protein; eukaryotic translation initiation factor 3, subunit 6 (48 kD); eukaryotic translation initiation factor 3, subunit 6 48 kDa; eukaryotic translation initiation factor 3, subunit E; eukaryotic translation initiation factor subunit E-like protein; Int6; mammary tumor integration site 6; mammary tumor-associated protein INT6; mammary tumor-associated protein INT-6; MMTV integration site 6; murine mammary tumor integration site 6 (oncogene homolog); NEWGENE_1311521; Viral integration site protein INT-6; viral integration site protein INT-6 homolog
• Common Name: eIF3e
• Gene Symbol: EIF3E
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining