missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human eIF3d (aa 286-370) Control Fragment Recombinant Protein

Product Code. 30207641
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207641

Brand: Invitrogen™ RP104811

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

eIF3D is a protein belonging to the largest of the eukaryotic translation initiation factor family, eukaryotic translation initiation factor-3 (eIF3). eIF3 is a multiprotein complex composed of at least 13 different subunits. eIF3D binds to the 40S ribosomal subunit and thus helps in maintaining the 40S and 60S ribosomal subunits in a dissociated state. An important role of eIF3D is the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and promotes mRNA binding. eIF3D is the major RNA binding subunit of the eIF3 complex. It associates with the subunit p170 of eIF-3. Ubiquitous expression of eIF3D is seen in most of the tissues and it is phosphorylated upon DNA damage, likely by ATM or ATR.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15371
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8664
Name Human eIF3d (aa 286-370) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 66/67 kDa; AA407891; actinin alpha 4; ACTININ-4; Actn4; alpha actinin 4; alpha-actinin-4; eIF3 p66; EIF3D; eIF3d {ECO:0000255; eIF3p66; eIF3-p66; Eif3s7; eIF-3-zeta; eIF3-zeta; eIF-3-zeta {ECO:0000255; eukaryotic translation initiation factor 3 subunit 7; eukaryotic translation initiation factor 3 subunit 7 {ECO:0000255; Eukaryotic translation initiation factor 3 subunit D; eukaryotic translation initiation factor 3 subunit D {ECO:0000255; eukaryotic translation initiation factor 3, subunit 7 (zeta); eukaryotic translation initiation factor 3, subunit 7 zeta; eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67 kDa; eukaryotic translation initiation factor 3, subunit D; F-actin cross-linking protein; focal segmental glomerulosclerosis 1; FSGS; FSGS1; HAMAP-Rule:MF_03003}; non-muscle alpha-actinin 4; RP5-1119A7.12-003; si:dkey-165I8.6; translation initiation factor eIF3 p66; translation initiation factor eIF3 p66 subunit; wu:fb12a03; zgc:64097
Common Name eIF3d
Gene Symbol EIF3D
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.