Invitrogen™ Human eIF3d (aa 190-267) Control Fragment Recombinant Protein

Product Code. 30200947

Brand: Invitrogen™ RP103625

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64268 (PA5-64268. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

eIF3D is a protein belonging to the largest of the eukaryotic translation initiation factor family, eukaryotic translation initiation factor-3 (eIF3). eIF3 is a multiprotein complex composed of at least 13 different subunits. eIF3D binds to the 40S ribosomal subunit and thus helps in maintaining the 40S and 60S ribosomal subunits in a dissociated state. An important role of eIF3D is the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and promotes mRNA binding. eIF3D is the major RNA binding subunit of the eIF3 complex. It associates with the subunit p170 of eIF-3. Ubiquitous expression of eIF3D is seen in most of the tissues and it is phosphorylated upon DNA damage, likely by ATM or ATR.

Specifications

• Accession Number: O15371
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8664
• Name: Human eIF3d (aa 190-267) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 66/67 kDa; AA407891; actinin alpha 4; ACTININ-4; Actn4; alpha actinin 4; alpha-actinin-4; eIF3 p66; EIF3D; eIF3d {ECO:0000255; eIF3p66; eIF3-p66; Eif3s7; eIF-3-zeta; eIF3-zeta; eIF-3-zeta {ECO:0000255; eukaryotic translation initiation factor 3 subunit 7; eukaryotic translation initiation factor 3 subunit 7 {ECO:0000255; Eukaryotic translation initiation factor 3 subunit D; eukaryotic translation initiation factor 3 subunit D {ECO:0000255; eukaryotic translation initiation factor 3, subunit 7 (zeta); eukaryotic translation initiation factor 3, subunit 7 zeta; eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67 kDa; eukaryotic translation initiation factor 3, subunit D; F-actin cross-linking protein; focal segmental glomerulosclerosis 1; FSGS; FSGS1; HAMAP-Rule:MF_03003}; non-muscle alpha-actinin 4; RP5-1119A7.12-003; si:dkey-165I8.6; translation initiation factor eIF3 p66; translation initiation factor eIF3 p66 subunit; wu:fb12a03; zgc:64097
• Common Name: eIF3d
• Gene Symbol: EIF3D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining