Invitrogen™ Human eIF3c (aa 511-580) Control Fragment Recombinant Protein

Product Code. 30205590

Brand: Invitrogen™ RP104421

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61425 (PA5-61425. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.

Specifications

• Accession Number: Q99613
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8663
• Name: Human eIF3c (aa 511-580) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 110 kDa; 3230401O13Rik; cell migration-inducing protein 17; eIF3 p110; eIF3 p110 {ECO:0000255; eIF3c; eIF3c {ECO:0000255; EIF3CL; eIF3-p110; EIF3S8; eukaryotic translation initiation factor 3 subunit 8; eukaryotic translation initiation factor 3 subunit 8 {ECO:0000255; Eukaryotic translation initiation factor 3 subunit C; eukaryotic translation initiation factor 3 subunit C {ECO:0000255; eukaryotic translation initiation factor 3, subunit 8 (110 kDa); eukaryotic translation initiation factor 3, subunit 8 (110 kD); eukaryotic translation initiation factor 3, subunit 8, 110 kDa; eukaryotic translation initiation factor 3, subunit C; extra-toes spotting; HAMAP-Rule:MF_03002}; NIPIL(A3); NipilA3; NIPI-like protein; Xs; Xsl
• Common Name: eIF3c
• Gene Symbol: Eif3c
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining