Invitrogen™ Human eIF3a (aa 431-508) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30207413	100 μL	100µL

Product Code. 30207413 Supplier Invitrogen™ Supplier No. RP97032

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83411 (PA5-83411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632, PubMed:11169732). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773, PubMed:27462815). [UniProt]

Specifications

• Accession Number: Q14152
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8661
• Name: Human eIF3a (aa 431-508) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 150/170; A830012B05Rik; Centrosomin; centrosomin homolog; Csma; cytoplasmic protein p167; Eif3; eIF3 p167; eIF3 p180; eIF3 p185; EIF3, p180 subunit; eIF3a; eIF3a {ECO:0000255; eIF3-p170; EIF3S10; eIF-3-theta; eIF3-theta; eIF-3-theta {ECO:0000255; eukaryotic translation initiation factor 3 subunit 10; EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 10 (EIF-3 THETA) (EIF3 P167) (EIF3 P180) (EIF3 P185) (P162 PROTEIN) (CENTROSOMIN); eukaryotic translation initiation factor 3 subunit 10 {ECO:0000255; eukaryotic translation initiation factor 3 subunit A; eukaryotic translation initiation factor 3 subunit A {ECO:0000255; eukaryotic translation initiation factor 3, subunit 10 (theta); eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170 kD); eukaryotic translation initiation factor 3, subunit 10 (theta, 170 kD); eukaryotic translation initiation factor 3, subunit 10 theta, 150/170 kDa; eukaryotic translation initiation factor 3, subunit 10, 170 kD; eukaryotic translation initiation factor 3, subunit A; HAMAP-Rule:MF_03000}; KIAA0139; mKIAA0139; p162; P167; p180; p185; TIF32; ZH12
• Common Name: eIF3a
• Gene Symbol: EIF3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining