missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human eIF3a (aa 431-508) Control Fragment Recombinant Protein

Product Code. 30207413
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30207413 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30207413 Supplier Invitrogen™ Supplier No. RP97032

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83411 (PA5-83411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632, PubMed:11169732). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773, PubMed:27462815). [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14152
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8661
Name Human eIF3a (aa 431-508) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 150/170; A830012B05Rik; Centrosomin; centrosomin homolog; Csma; cytoplasmic protein p167; Eif3; eIF3 p167; eIF3 p180; eIF3 p185; EIF3, p180 subunit; eIF3a; eIF3a {ECO:0000255; eIF3-p170; EIF3S10; eIF-3-theta; eIF3-theta; eIF-3-theta {ECO:0000255; eukaryotic translation initiation factor 3 subunit 10; EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 10 (EIF-3 THETA) (EIF3 P167) (EIF3 P180) (EIF3 P185) (P162 PROTEIN) (CENTROSOMIN); eukaryotic translation initiation factor 3 subunit 10 {ECO:0000255; eukaryotic translation initiation factor 3 subunit A; eukaryotic translation initiation factor 3 subunit A {ECO:0000255; eukaryotic translation initiation factor 3, subunit 10 (theta); eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170 kD); eukaryotic translation initiation factor 3, subunit 10 (theta, 170 kD); eukaryotic translation initiation factor 3, subunit 10 theta, 150/170 kDa; eukaryotic translation initiation factor 3, subunit 10, 170 kD; eukaryotic translation initiation factor 3, subunit A; HAMAP-Rule:MF_03000}; KIAA0139; mKIAA0139; p162; P167; p180; p185; TIF32; ZH12
Common Name eIF3a
Gene Symbol EIF3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.