Invitrogen™ Human eIF2b beta (aa 36-186) Control Fragment Recombinant Protein

Product Code. 30193829

Brand: Invitrogen™ RP103014

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61636 (PA5-61636. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

eIF2b beta is the beta subunit of eukaryotic initiation factor-2B (EIF2B). EIF2B is involved in protein synthesis and exchanges GDP and GTP for its activation and deactivation.

Specifications

• Accession Number: P49770
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8892
• Name: Human eIF2b beta (aa 36-186) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA409345; C85417; EIF2B; eIF-2 B GDP-GTP exchange factor subunit beta; Eif2b2; EIF2BB; EIF-2 Bbeta; eukaryotic translation initiation factor 2 B subunit beta; eukaryotic translation initiation factor 2 B, subunit 2 (beta, 39 kD); eukaryotic translation initiation factor 2 B, subunit 2 beta; eukaryotic translation initiation factor 2 B, subunit 2 beta, 39 kDa; S20I15; S20III15; translation initiation factor eIF-2 B subunit beta
• Common Name: eIF2b beta
• Gene Symbol: Eif2b2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RETLGLLRQIITDHRWSNAGELMELIRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining