Invitrogen™ Human eIF2b alpha (aa 219-305) Control Fragment Recombinant Protein

Product Code. 30208823

Brand: Invitrogen™ RP104873

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65564 (PA5-65564. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.

Specifications

• Accession Number: Q14232
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1967
• Name: Human eIF2b alpha (aa 219-305) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 26 kDa; D5Ertd406e; eIF-2 A; EIF2B; eIF-2 B GDP-GTP exchange factor subunit alpha; Eif2b1; EIF2BA; eIF-2 Balpha; eukaryotic translation initiation factor 2 B subunit alpha; eukaryotic translation initiation factor 2 B, subunit 1 (alpha); eukaryotic translation initiation factor 2 B, subunit 1 (alpha, 26 kDa); eukaryotic translation initiation factor 2 B, subunit 1 alpha; eukaryotic translation initiation factor 2 B, subunit 1 alpha, 26 kDa; GTP-exchange protein; translation initiation factor eIF-2 B subunit alpha
• Common Name: eIF2b alpha
• Gene Symbol: EIF2B1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining