missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EID3 (aa 136-216) Control Fragment Recombinant Protein

Product Code. 30212922
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212922

Brand: Invitrogen™ RP101962

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63712 (PA5-63712. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tissue-specific component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N140
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 493861
Name Human EID3 (aa 136-216) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700027M21Rik; E1A-like inhibitor of differentiation 3; EID-1-like inhibitor of differentiation 3; Eid3; EID-3; eid3 {ECO:0000312; EMBL:AAH97404.1}; EP300 interacting inhibitor of differentiation 3; EP300-interacting inhibitor of differentiation 3; non-SMC element 4 homolog B; non-structural maintenance of chromosomes element 4 homolog B; NS4EB; NSE4B; NSMCE4B; testis tissue sperm-binding protein Li 96 mP
Common Name EID3
Gene Symbol EID3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt