Invitrogen™ Human EID3 (aa 136-216) Control Fragment Recombinant Protein

Product Code. 30212922

Brand: Invitrogen™ RP101962

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63712 (PA5-63712. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tissue-specific component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components. [UniProt]

Specifications

• Accession Number: Q8N140
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 493861
• Name: Human EID3 (aa 136-216) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700027M21Rik; E1A-like inhibitor of differentiation 3; EID-1-like inhibitor of differentiation 3; Eid3; EID-3; eid3 {ECO:0000312; EMBL:AAH97404.1}; EP300 interacting inhibitor of differentiation 3; EP300-interacting inhibitor of differentiation 3; non-SMC element 4 homolog B; non-structural maintenance of chromosomes element 4 homolog B; NS4EB; NSE4B; NSMCE4B; testis tissue sperm-binding protein Li 96 mP
• Common Name: EID3
• Gene Symbol: EID3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining