Invitrogen™ Human EID1 (aa 97-183) Control Fragment Recombinant Protein

Product Code. 30181016

Brand: Invitrogen™ RP98153

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62323 (PA5-62323. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E1A-like inhibitor of differentiation-1 (EID-1), an acetyltransferase enzyme, binds both the retinoblastoma protein (Rb), a regulator of cell cycle and tissue specific transcription, and the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. EID-1 inhibits cellular differentiation by blocking the histone acetyltransferase activity of p300. EID-1 also acetylates both histones and non-histone proteins such as NCOA3 co-activator. By acetylating histones, EID-1 gives a specific tag for transcriptional activation. In addition to binding Rb and p300, EID-1 also binds to phosphorylated CREB protein, mediating cAMP gene regulation. EID-1 augments the activity of phosphorylated CREB and activates transcription of cAMP responsive genes as a co-activator.

Specifications

• Accession Number: Q9Y6B2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23741
• Name: Human EID1 (aa 97-183) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 21 kDa pRb-associated protein; 2610002K20Rik; C15orf3; CREBBP/EP300 inhibitor 1; CREBBP/EP300 inhibitory protein 1; CRI1; E1A-like inhibitor of differentiation 1; EID; eid1; EID-1; EP300 interacting inhibitor of differentiation 1; EP300-interacting inhibitor of differentiation 1; IRO45620; NB4 apoptosis related protein; ORF12; PNAS-22; PTD014; Rb- and p300-binding protein EID-1; RBP21; retinoblastoma protein-associated protein; RGD1562702
• Common Name: EID1
• Gene Symbol: EID1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining