missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EHHADH (aa 634-711) Control Fragment Recombinant Protein

Product Code. 30199154
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199154

Brand: Invitrogen™ RP103761

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83586 (PA5-83586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As an L-hydroxy-specific enzyme, EHHADH (enoyl-CoA-hydratase:3-hydroxyacyl-CoA dehydrogenase), also known as Peroxisomal L-bifunctional enzyme, is a 723 amino acid protein has an essential tripeptide sequence on its carboxyl-terminus that is required for peroxisomal transport. EHHADH-null mice only exhibit a blunted peroxisome proliferative response when challenged with a peroxisome proliferator. Since there were no observed changes in lipid metabolism, this evidence suggests that enoyl-CoAs were diverted to the D-hydroxy-specific beta-oxidation system for metabolism.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q08426
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1962
Name Human EHHADH (aa 634-711) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1; 1300002P22Rik; 3,2-trans-enoyl-CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; ECHD; EHHADH; Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase; enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase; enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase; FRTS3; HD; L-3-hydroxyacyl-CoA dehydrogenase; LBFP; L-bifunctional enzyme; L-bifunctional protein, peroxisomal; Lbp; L-PBE; L-specific bifunctional protein; L-specific multifunctional beta-oxdiation protein; MEF; Mfe; Mfe1; MFP; MFP1; multifunctional enzyme type 1; Pbe; PBFE; perMFE-1; Peroxisomal bifunctional enzyme; peroxisomal bifunctional enzyme type 1; peroxisomal enoyl-CoA hydratase
Common Name EHHADH
Gene Symbol EHHADH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.