Invitrogen™ Human EHHADH (aa 153-248) Control Fragment Recombinant Protein

Product Code. 30207009

Brand: Invitrogen™ RP96322

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83334 (PA5-83334. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As an L-hydroxy-specific enzyme, EHHADH (enoyl-CoA-hydratase:3-hydroxyacyl-CoA dehydrogenase), also known as Peroxisomal L-bifunctional enzyme, is a 723 amino acid protein has an essential tripeptide sequence on its carboxyl-terminus that is required for peroxisomal transport. EHHADH-null mice only exhibit a blunted peroxisome proliferative response when challenged with a peroxisome proliferator. Since there were no observed changes in lipid metabolism, this evidence suggests that enoyl-CoAs were diverted to the D-hydroxy-specific beta-oxidation system for metabolism.

Specifications

• Accession Number: Q08426
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1962
• Name: Human EHHADH (aa 153-248) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1; 1300002P22Rik; 3,2-trans-enoyl-CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; ECHD; EHHADH; Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase; enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase; enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase; FRTS3; HD; L-3-hydroxyacyl-CoA dehydrogenase; LBFP; L-bifunctional enzyme; L-bifunctional protein, peroxisomal; Lbp; L-PBE; L-specific bifunctional protein; L-specific multifunctional beta-oxdiation protein; MEF; Mfe; Mfe1; MFP; MFP1; multifunctional enzyme type 1; Pbe; PBFE; perMFE-1; Peroxisomal bifunctional enzyme; peroxisomal bifunctional enzyme type 1; peroxisomal enoyl-CoA hydratase
• Common Name: EHHADH
• Gene Symbol: EHHADH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining