Invitrogen™ Human EHF (aa 1-85) Control Fragment Recombinant Protein

Product Code. 30201638

Brand: Invitrogen™ RP103380

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-84038 (PA5-84038, PA5-63890 (PA5-63890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be associated with asthma susceptibility. This protein may be involved in epithelial differentiation and carcinogenesis.

Specifications

• Accession Number: Q9NZC4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26298
• Name: Human EHF (aa 1-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9030625L19Rik; AU019492; EHF; Epithelium-specific Ets transcription factor 3; ESE3; ESE-3; ESE3 transcription factor; ESE3B; ESEJ; ETS domain-containing transcription factor; ETS homologous factor; hEHF; Unknown (protein for MGC:133971)
• Common Name: EHF
• Gene Symbol: EHF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining