Invitrogen™ Human EHD1 Control Fragment Recombinant Protein

Product Code. 30197073

Brand: Invitrogen™ RP105436

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66950 (PA5-66950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EHD1 acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes. EHD1 also plays a role in myoblast fusion and is recruited to endosomal membranes upon nerve growth factor stimulation, indirectly regulates neurite outgrowth. Further, EHD1 belongs to a highly conserved gene family encoding EPS15 homology (EH) domain-containing proteins. The protein-binding EH domain was first noted in EPS15, a substrate for the epidermal growth factor receptor. The EH domain has been shown to be an important motif in proteins involved in protein-protein interactions and in intracellular sorting. The EHD1 protein is thought to play a role in the endocytosis of IGF1 receptors. Alternatively spliced transcript variants have been found for the EHD1 gene.

Specifications

• Accession Number: Q9H4M9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10938
• Name: Human EHD1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA409636; CDABP0131; EH domain containing 1; EH domain-containing protein 1; Ehd1; EH-domain containing 1; H-PAST; HPAST1; mPAST1; PAST; PAST homolog 1; PAST1; RGD1306960; RME-1; testilin
• Common Name: EHD1
• Gene Symbol: EHD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEQPGTAASPVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining