Invitrogen™ Human EGFLAM (aa 693-784) Control Fragment Recombinant Protein

Product Code. 30203400

Brand: Invitrogen™ RP109107

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140117 (PA5-140117. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in both the retinal photoreceptor ribbon synapse formation and physiological functions of visual perception. Necessary for proper bipolar dendritic tip apposition to the photoreceptor ribbon synapse. Promotes matrix assembly and cell adhesiveness.

Specifications

• Accession Number: Q63HQ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 133584
• Name: Human EGFLAM (aa 693-784) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5930412K08; AGRINL; Agrin-like protein; AGRNL; AU040377; EGF like, fibronectin type III and laminin G domains; Egflam; EGF-like, fibronectin type III and laminin G domains; EGF-like, fibronectin type-III and laminin G-like domain-containing protein; Nectican; PIKA; Pikachurin; RGD1306592
• Common Name: EGFLAM
• Gene Symbol: EGFLAM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining