Invitrogen™ Human EGFL6 (aa 402-546) Control Fragment Recombinant Protein

Product Code. 30198734

Brand: Invitrogen™ RP94750

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51642 (PA5-51642. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8IUX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25975
• Name: Human EGFL6 (aa 402-546) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EGF like domain multiple 6; EGF repeat-containing protein 6; EGFL6; EGF-like protein 6; EGF-like-domain, multiple 6; Epidermal growth factor-like protein 6; Maeg; MAM and EGF domain containing; MAM and EGF domains-containing gene protein; PP648; Protein W80; UNQ281/PRO320; W80
• Common Name: EGFL6
• Gene Symbol: EGFL6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining