Invitrogen™ Human EGFL5 (aa 365-497) Control Fragment Recombinant Protein

Product Code. 30195892

Brand: Invitrogen™ RP106266

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65602 (PA5-65602. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MEGF9 is a protein coding gene.

Specifications

• Accession Number: Q9H1U4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1955
• Name: Human EGFL5 (aa 365-497) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933405H16Rik; 9630025C07; EGFL5; EGF-like protein 5; EGF-like-domain, multiple 5; Epidermal growth factor-like protein 5; KIAA0818; Megf9; mKIAA0818; multiple EGF like domains 9; multiple EGF-like domains protein 9; multiple EGF-like-domains 9; multiple epidermal growth factor-like domains protein 9; UNQ671/PRO1305
• Common Name: EGFL5
• Gene Symbol: MEGF9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTIFSVST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining