Invitrogen™ Human EGFL4 (aa 1914-2045) Control Fragment Recombinant Protein

Product Code. 30197717

Brand: Invitrogen™ RP89893

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61917 (PA5-61917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EGFL4 (epidermal growth factor-like protein 4), also known as MEGF8 (multiple epidermal growth factor-like domains protein 8) or C19orf49, is a 2,845 amino acid single-pass type I membrane protein. EGFL4 contains 2 CUB domains, 5 EGF-like domains, 12 Kelch repeats, 4 laminin EGF-like domains and 7 PSI domains. Existing as two alternatively spliced isoforms, the gene encoding EGFL4 maps to human chromosome 19q13.2. Chromosome 19 consists of approximately 63 million bases, makes up over 2% of human genomic DNA, and is recognized for having the greatest gene density of the human chromosomes. It is the genetic home for a number of immunoglobulin superfamily members including the killer cell and leukocyte Ig-like receptors.

Specifications

• Accession Number: Q7Z7M0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1954
• Name: Human EGFL4 (aa 1914-2045) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW049492; b2b1702Clo; b2b288Clo; C19orf49; CRPT2; EGFL4; EGF-like domain-containing protein 4; EGF-like protein 4; EGF-like-domain, multiple 4; Epidermal growth factor-like protein 4; HBV pre-s2 binding protein 1; HBV pre-S2-binding protein 1; hepatitis B virus pre-S2-binding protein 1; KIAA0817; m687Ddg; Megf8; mKIAA0817; multiple EGF like domains 8; multiple EGF-like domain protein 4; multiple EGF-like domains protein 8; multiple EGF-like-domains 8; multiple epidermal growth factor-like domains protein 8; SBP1
• Common Name: EGFL4
• Gene Symbol: MEGF8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining