Invitrogen™ Human EFR3B (aa 457-525) Control Fragment Recombinant Protein

Product Code. 30209386

Brand: Invitrogen™ RP109266

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139908 (PA5-139908. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane. The complex acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis (Probable). In the complex, EFR3B probably acts as the membrane-anchoring component. Also involved in responsiveness to G-protein-coupled receptors; it is however unclear whether this role is direct or indirect.

Specifications

• Accession Number: Q9Y2G0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22979
• Name: Human EFR3B (aa 457-525) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI852640; C030014M07Rik; EFR3 homolog B; EFR3 homolog B (S. cerevisiae); Efr3b; FLJ37871; Kiaa0953; mKIAA0953; Protein EFR3 homolog B; RGD1310845
• Common Name: EFR3B
• Gene Symbol: EFR3B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining