missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210552

Invitrogen™ Human EFCAB4A Control Fragment Recombinant Protein

Product Code. 30210552
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210552

Brand: Invitrogen™ RP97506

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61187 (PA5-61187. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EFCAB4A, also known as Calcium release-activated calcium channel regulator 2B, is a novel Ca2+-binding EF-hand protein that is thought to play a key role in store-operated Ca2+ entry in T-cells by regulating CRAC channel activation, but the detailed function is still under investigation. It is likely to play a similar role as the related protein EFCAB4B, which acts as a cytoplasmic calcium-sensor that forms a complex with ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca2+ concentration.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N4Y2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 283229
Name Human EFCAB4A Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330520A15Rik; BC026645; Ca2+ release-activated Ca2+ (CRAC) channel regulator 2 B; calcium release activated channel regulator 2 B; calcium release-activated calcium channel regulator 2 B; Calcium release-activated channel regulator 2 B; CRAC channel regulator 2 B; CRAC regulator 2 B; Cracr2a; CRACR2B; Efcab4; EFCAB4A; EF-hand calcium binding domain 4 A; EF-hand calcium-binding domain-containing protein 4 A; RGD1560911
Common Name EFCAB4A
Gene Symbol CRACR2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEAVFESLDQAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.