missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200547

Invitrogen™ Human EEF1E1 (aa 123-174) Control Fragment Recombinant Protein

Product Code. 30200547
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200547

Brand: Invitrogen™ RP106799

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66108 (PA5-66108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43324
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9521
Name Human EEF1E1 (aa 123-174) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110003A02Rik; AIMP3; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; Eef1e1; Elongation factor p18; eukaryotic translation elongation factor 1 epsilon 1; eukaryotic translation elongation factor 1 epsilon-1; Multisynthase complex auxiliary component p18; multisynthetase complex auxiliary component p18; P18; p18 component of aminoacyl-tRNA synthetase complex
Common Name EEF1E1
Gene Symbol EEF1E1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.