Invitrogen™ Human EEF1D (aa 74-169) Control Fragment Recombinant Protein

Product Code. 30197799

Brand: Invitrogen™ RP104916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111323 (PA5-111323. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.

Specifications

• Accession Number: P29692
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1936
• Name: Human EEF1D (aa 74-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: antigen NY-CO-4; EEF 1 D; Eef1d; EF 1 delta; EF 1 D; EF1D; EF-1 D; EF-1-delta; Elongation factor 1-delta; eukaryotic translation elongation factor 1 delta; eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein); FP1047; guanine nucleotide exchange protein; translation elongation factor 1-delta subunit
• Common Name: EEF1D
• Gene Symbol: EEF1D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining