Invitrogen™ Human EDIL3 (aa 221-316) Control Fragment Recombinant Protein

Product Code. 30199659

Brand: Invitrogen™ RP109709

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144728 (PA5-144728. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Del-1 is an integrin ligand that is expressed by endothelial cells during embryological vascular development. It promotes adhesion of endothelial cells through an interaction with the alpha-v/beta-3 integrin receptor. Del-1 plays a vital role in mediating angiogenesis.

Specifications

• Accession Number: O43854
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10085
• Name: Human EDIL3 (aa 221-316) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Del1; Del-1; developmental endothelial locus-1; developmentally-regulated endothelial cell locus 1 protein; Edil3; EGF like repeats and discoidin domains 3; EGF-like repeat and discoidin I-like domain-containing protein 3; EGF-like repeats and discoidin I-like domains 3; integrin-binding protein DEL1
• Common Name: EDIL3
• Gene Symbol: EDIL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining