Invitrogen™ Human EDG4 (aa 258-348) Control Fragment Recombinant Protein

Product Code. 30204188

Brand: Invitrogen™ RP90853

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54038 (PA5-54038. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Edg4 is a Lysophospholipid/Lysosphingolipid Receptor activated by phosphatidic acid (PA) and lysophosphatidic acid (LPA). It enhances the transcription of serum response element (SRE) reporter genes. In CD4(+) T cells, Edg4 may be involved in the control of interleukin-2 secretion. Edg4 expression has been documented in leukocytes, pancreas, spleen, thymus, prostate, and testis. Edg4 expression has also been seen in many cancer cell lines, including those of brain, blood, breast, ovary, cervix, colon, skin, and thyroid. ESTs have been isolated from B-cell/lung/testis, blood, brain, embryo, heart/melanocyte/uterus, liver, placenta, prostate, and skin libraries.

Specifications

• Accession Number: Q9HBW0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9170
• Name: Human EDG4 (aa 258-348) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Edg4; EDG-4; endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor 4; endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 4; G protein-coupled receptor; IPA2; LPA receptor 2; LPA receptor EDG4; LPA2; LPA-2; LPA2 Receptor; LPAR2; Lysophosphatidic acid receptor 2; lysophosphatidic acid receptor EDG4; lysophosphatidic acid receptor Edg-4; Pbx4; pre-B-cell leukemia transcription factor 4; RGD1561336
• Common Name: EDG4
• Gene Symbol: LPAR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining