Invitrogen™ Human EDDM3B (aa 27-147) Control Fragment Recombinant Protein

Product Code. 30212409

Brand: Invitrogen™ RP88881

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51559 (PA5-51559. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells.

Specifications

• Accession Number: P56851
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64184
• Name: Human EDDM3B (aa 27-147) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EDDM3B; EP3B; epididymal protein 3 B; epididymal secretory protein E3 beta; epididymal secretory protein E3-beta; FAM12B; family with sequence similarity 12, member B (epididymal); HE3B; HE3-BETA; human epididymis-specific 3 beta; human epididymis-specific protein 3-beta; RAM2; ribonuclease A M2; UNQ6412/PRO21187
• Common Name: EDDM3B
• Gene Symbol: EDDM3B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLKMVEPIGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining