Invitrogen™ Human EDDM3A (aa 57-121) Control Fragment Recombinant Protein

Product Code. 30181661

Brand: Invitrogen™ RP99947

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62105 (PA5-62105. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q14507
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10876
• Name: Human EDDM3A (aa 57-121) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EDDM3A; EP3A; epididymal protein 3 A; epididymal secretory protein E3 alpha; epididymal secretory protein E3-alpha; epididymis-specific 3 alpha; FAM12A; family with sequence similarity 12, member A; HE3A; HE3ALPHA; HE3-ALPHA; human epididymis-specific 3 alpha; human epididymis-specific protein 3-alpha; RAM1; ribonuclease A M1
• Common Name: EDDM3A
• Gene Symbol: EDDM3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining