Invitrogen™ Human EDC4 (aa 427-534) Control Fragment Recombinant Protein

Product Code. 30207051

Brand: Invitrogen™ RP106036

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In the process of mRNA degradation, seems to play a role in mRNA decapping. Component of a complex containing DCP2 and DCP1A which functions in decapping of ARE-containing mRNAs. Promotes complex formation between DCP1A and DCP2. Enhances the catalytic activity of DCP2 (in vitro).

Specifications

• Accession Number: Q6P2E9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23644
• Name: Human EDC4 (aa 427-534) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Autoantigen Ge-1; autoantigen RCD8; autoantigen RCD-8; BC022641; Edc4; enhancer of mRNA decapping 4; enhancer of mRNA-decapping protein 4; fe26b05; GE1; Ge-1; HEDL5; HEDLS; Human enhancer of decapping large subunit; LRRG00115; Nrn1l; RCD8; RCD-8; RGD1309136; si:ch211-237c7.1; si:dkey-16n13.6; wu:fe26b05
• Common Name: EDC4
• Gene Symbol: EDC4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining