missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EDC3 (aa 222-306) Control Fragment Recombinant Protein

Product Code. 30199069
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199069

Brand: Invitrogen™ RP105383

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84710 (PA5-84710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96F86
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80153
Name Human EDC3 (aa 222-306) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA517853; EDC3; enhancer of mRNA decapping 3; enhancer of mRNA decapping 3 homolog; enhancer of mRNA decapping 3 homolog (S. cerevisiae); enhancer of mRNA-decapping protein 3; hYjeF_N2; hYjeF_N2-15q23; hypothetical protein FLJ21128; hypothetical protein LOC504054; im:7151288; Lsm16; LSM16 homolog; LSM16 homolog (EDC3, S. cerevisiae); LSM16 protein homolog; MRT50; PP844; RGD1306898; wu:fb82d07; Yjdc; yjeF domain containing; yjeF domain-containing protein 1; YjeF N-terminal domain-containing protein 2; yjeF_N2; YJEFN2; zgc:112006
Common Name EDC3
Gene Symbol Edc3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.