Invitrogen™ Human EDARADD (aa 110-211) Control Fragment Recombinant Protein

Product Code. 30199755

Brand: Invitrogen™ RP92324

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53860 (PA5-53860. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8WWZ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 128178
• Name: Human EDARADD (aa 110-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: crinkled homolog; ECTD11A; ECTD11B; ectodysplasia A receptor associated death domain; ectodysplasin A receptor associated adapter protein; ectodysplasin-A receptor-associated adapter protein; ED3; EDA3; EDAR associated death domain; EDARADD; EDAR-associated death domain protein; Protein crinkled homolog
• Common Name: EDARADD
• Gene Symbol: EDARADD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining