Invitrogen™ Human Ecm 29 (aa 1370-1482) Control Fragment Recombinant Protein

Product Code. 30195822

Brand: Invitrogen™ RP103820

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84437 (PA5-84437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ecm 29 appears to be one of three proteins which associate significantly with proteasomes. Ecm 29 has been shown to enhance the stability of the proteasome. Ecm 29 deletion has been shown to produce 26S proteasomes which dissociated in the absence of ATP. It was thus suggested that Ecm 29 tethers the regulatory complex to the proteasome.

Specifications

• Accession Number: Q5VYK3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23392
• Name: Human ECM29 (aa 1370-1482) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI314180; AW558785; BB181316; ECM29; ECM29 homolog, proteasome accessory protein; Ecpas; expressed sequence AI314180; FLJ22036; homolog of yeast Ecm29; KIAA0368; KIAA1962; mKIAA0368; Proteasome adapter and scaffold protein ECM29; Proteasome-associated protein ECM29 homolog; RP11-386D8.2
• Common Name: ECM29
• Gene Symbol: ECPAS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYSPDVLKNHAKEVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining