Invitrogen™ Human ECM1 (aa 141-229) Control Fragment Recombinant Protein

Product Code. 30200358

Brand: Invitrogen™ RP109529

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ECM1, also referred to as extracellular matrix protein 1, is a protein that plays a significant role in regulating extracellular matrix organization and cell adhesion. It is expressed in various tissues, including the skin, lung, and liver, and is involved in the development and progression of several diseases, including cancer and dermatological disorders. The protein interacts with several extracellular matrix proteins, such as collagen and fibronectin, and is involved in the regulation of cell proliferation, migration, and invasion. ECM1 is also involved in endochondral bone formation, angiogenesis, and tumor biology. It interacts with various extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. Mutations in this gene are associated with lipoid proteinosis disorder (also known as hyalinosis cutis et mucosae or Urbach-Wiethe disease) that is characterized by generalized thickening of skin, mucosae, and certain viscera. Different isoforms of ECM1 have been described in alternatively spliced transcript variants. Diseases associated with ECM1 include Lipoid Proteinosis Of Urbach And Wiethe and Lichen Sclerosus Et Atrophicus.

Specifications

• Accession Number: Q16610
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1893
• Name: Human ECM1 (aa 141-229) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI663821; ECM1; Extracellular matrix protein 1; LOW QUALITY PROTEIN: extracellular matrix protein 1; extracellular matrix protein 1; p85; RP11-54A4.6; Secretory component p85; testicular tissue protein Li 61; URBWD
• Common Name: ECM1
• Gene Symbol: ECM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining