Abnova™ Human ECHS1 Partial ORF (AAH08906.1, 28 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001892-Q01.10ug

Product Code. 16073915

Description

The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq]

Sequence: ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVK

Specifications

• Accession Number: AAH08906.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 36.63kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVK
• Regulatory Status: RUO
• Common Name: ECHS1
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 1892
• Name: ECHS1 (Human) Recombinant Protein (Q01)
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: SCEH
• Gene Symbol: ECHS1
• Recombinant: Recombinant
• Expression System: wheat germ expression system