Invitrogen™ Human EARS2 (aa 67-145) Control Fragment Recombinant Protein

Product Code. 30180681

Brand: Invitrogen™ RP98631

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60445 (PA5-60445. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamyl-tRNA synthetase (GluRS or EARS2) a class I aminoacyl-tRNA synthetase (aaRS), is primarily responsible for the glutamylation of tRNAGlu. It is part of the 'minimal set' of seventeen aaRSs found in every living organism and its presence is essential for the viability of cells.

Specifications

• Accession Number: Q5JPH6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 124454
• Name: Human EARS2 (aa 67-145) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3230401I01Rik; COXPD12; Ears2; GluRS; glutamate tRNA ligase 2, mitochondrial; glutamate--tRNA ligase; Glutamyl-tRNA synthetase; glutamyl-tRNA synthetase 2 (mitochondrial)(putative); glutamyl-tRNA synthetase 2 mitochondrial (putative); glutamyl-tRNA synthetase 2, mitochondrial; Kiaa1970; mKIAA1970; MSE1; Probable glutamate--tRNA ligase, mitochondrial; probable glutamyl-tRNA synthetase, mitochondrial; RGD1307904
• Common Name: EARS2
• Gene Symbol: Ears2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YQGSFILRLEDTDQTRVVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELYAQATEALLKTGAAYPCFCSPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining