Invitrogen™ Human EAPP (aa 32-142) Control Fragment Recombinant Protein

Product Code. 30209594

Brand: Invitrogen™ RP89046

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51774 (PA5-51774. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein may play an important role in the fine-tuning of both major E2F1 activities, the regulation of the cell-cycle and the induction of apoptosis. Promotes S-phase entry, and inhibits p14(ARP) expression. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The C-terminal of EAPP binds the N-terminal of E2F1 and also interacts with E2F2 and E2F3, but not E2F4.

Specifications

• Accession Number: Q56P03
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55837
• Name: Human EAPP (aa 32-142) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810011O16Rik; BM036; BM-036; c14orf11; E2F associated phosphoprotein; E2F-associated phosphoprotein; Eapp; hypothetical protein LOC327318; RGD1309624; Unknown (protein for MGC:139672); wu:fd21g02; zgc:65820
• Common Name: EAPP
• Gene Symbol: EAPP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYDPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining