Invitrogen™ Human EAAT4 (aa 196-262) Control Fragment Recombinant Protein

Product Code. 30180737

Brand: Invitrogen™ RP98970

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59600 (PA5-59600. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Slc1a6 encodes a protein that is a glutamate transporters, also known as excitatory amino acid transporters (EAATs), are sodium- and potassium-dependent members of the solute carrier family 6 (SLC1), widely distributed throughout the brain. There are five EAAT subtypes, each with a specific distribution. Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Slc1a6 functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion. Slc1a6 also mediates Cl(-) flux that is not coupled to amino acid transport and this avoids the accumulation of negative charges due to aspartate and Na(+) symport. Further, Slc1a6 [lays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (Probable). Diseases associated with SLC1A6 include Dicarboxylic Aminoaciduria.

Specifications

• Accession Number: P48664
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6511
• Name: Human EAAT4 (aa 196-262) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EAAT4; Excitatory amino acid transporter 4; high affinity aspartate/glutamate transporter; high-affinity neuronal glutamate transporter; Slc1a6; Sodium-dependent glutamate/aspartate transporter; solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6; solute carrier family 1 member 6; solute carrier family 1, member 6
• Common Name: EAAT4
• Gene Symbol: SLC1A6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining