missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206610

Invitrogen™ Human DZIP3 (aa 434-531) Control Fragment Recombinant Protein

Product Code. 30206610
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206610

Brand: Invitrogen™ RP96481

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 Ubiquitin ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Able to specifically bind RNA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86Y13
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9666
Name Human DZIP3 (aa 434-531) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310047C04Rik; 2 A-HUB; 6430549P11Rik; A230104G20; DAZ interacting protein 3, zinc finger; DAZ interacting zinc finger protein 3; DAZ-interacting protein 3; DAZ-interacting protein 3 homolog; DZIP3; E3 ubiquitin-protein ligase DZIP3; hRUL138; human RNA-binding ubiquitin ligase of 138 kDa; Kiaa0675; PPP1R66; protein phosphatase 1, regulatory subunit 66; RGD1563278; RING-type E3 ubiquitin transferase DZIP3; RNA-binding RING-H2 protein-ubiquitin ligase; RNA-binding ubiquitin ligase of 138 kDa; UURF2; UURF2 ubiquitin ligase; zinc finger DAZ interacting protein 3
Common Name DZIP3
Gene Symbol DZIP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLCLLLALIKHLNVFPAPKKGWNMEPPSSDISKSADILRLCKYRDILLSEILMNGLTESQFNSIWK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.