Invitrogen™ Human DZIP1L (aa 459-543) Control Fragment Recombinant Protein

Product Code. 30195462

Brand: Invitrogen™ RP95520

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56462 (PA5-56462. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8IYY4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 199221
• Name: Human DZIP1L (aa 459-543) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DAZ interacting protein 1-like; DAZ interacting zinc finger protein 1 like; DAZ interacting zinc finger protein 1-like; DAZ-interacting protein 1-like protein; DZIP1L; DZIP2; Zinc finger protein DZIP1L
• Common Name: DZIP1L
• Gene Symbol: DZIP1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEDTLEEKLESMGIRKDAKGISIQTLRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAVVSQPDGQPSVKSQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining