missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211737

Invitrogen™ Human Dystrophin (aa 186-333) Control Fragment Recombinant Protein

Product Code. 30211737
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211737

Brand: Invitrogen™ RP92152

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dystrophin is the 427kDa protein product of the DMB/BMD gene located on the X chromosome at position Xp21. Western blotting and immunohistochemistry are the two established methods for the detection of abnormalities of dystrophin expression in muscle biopsies. Dystrophin abnormalities are thought to occur in 100% of patients with DMD/BMD, although genetic abnormalities may only be detected in up to 65% of cases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P11532
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1756
Name Human Dystrophin (aa 186-333) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias apodystrophin-3; apodystrophin-I; BMD; CMD3B; dmd; dmd0.1; dmd0.1.L; DNADMD1; Dp427; Dp71; Duchenne muscular dystrophy (DMD); DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272; DXSmh7; DXSmh9; dys; Dystrophin; dystrophin Dp40; dystrophin Dp71 isoform; dystrophin Dp71a; dystrophin Dp71ab; dystrophin Dp71b; dystrophin, gene 1 L homeolog; dystrophin, muscular dystrophy; GS1-19O24.1; mdx; MR x 85; Muscular dystrophy Duchenne and Becker types; OTTHUMP00000215592; Pk.; utrn; utrophin; XELAEV_18012903mg; X-linked muscular dystrophy
Common Name Dystrophin
Gene Symbol DMD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQAAYVTTSDPTRSPFPSQHLEAPEDKSFGSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.