Invitrogen™ Human DYRK4 (aa 295-385) Control Fragment Recombinant Protein

Product Code. 30212912

Brand: Invitrogen™ RP95196

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55758 (PA5-55758. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dual-specificity kinases, such as DYRK4, play key roles in cell proliferation, survival, and development.

Specifications

• Accession Number: Q9NR20
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8798
• Name: Human DYRK4 (aa 295-385) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW049118; dual specificity tyrosine phosphorylation regulated kinase 4; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 4; dual specificity tyrosine-phosphorylation-regulated kinase 4; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4; dyrk4; Dyrk4a; Dyrk4b; RAD51 associated protein 1; Rad51ap1
• Common Name: DYRK4
• Gene Symbol: Dyrk4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining