missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198933

Invitrogen™ Human DYNC2LI1 (aa 273-349) Control Fragment Recombinant Protein

Product Code. 30198933
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198933

Brand: Invitrogen™ RP103477

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64075 (PA5-64075. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DYNC2LI1 (dynein, cytoplasmic 2, light intermediate chain 1), also known as LIC3, D2LIC or CGI-60, is a 351 amino acid cytoplasmic protein belonging to the dynein light intermediate chain family. DYNC2LI1 may function as a motor for intraflagellar retrograde transport and in cilia biogenesis. The cytoplasmic dynein complex 2 may be composed of a DYNC2H1 homodimer and a number of DYNC2LI1 light intermediate chains. DYNC2LI1 exists as five alternatively spliced isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TCX1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51626
Name Human DYNC2LI1 (aa 273-349) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933404O11Rik; CGI-60; Cytoplasmic dynein 2 light intermediate chain 1; D2LIC; Dync2li1; Dynein 2 light intermediate chain; dynein cytoplasmic 2 light intermediate chain 1; dynein, cytoplasmic 2, light intermediate chain 1; LIC3; mD2LIC; RGD1310286
Common Name DYNC2LI1
Gene Symbol Dync2li1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.