Invitrogen™ Human DYNC1I2 (aa 126-174) Control Fragment Recombinant Protein

Product Code. 30201474

Brand: Invitrogen™ RP102895

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59226 (PA5-59226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dyneins are multi-subunit, high molecular weight ATPases that interact with microtubules to generate force by converting the chemical energy of ATP into the mechanical energy of movement. Cytoplasmic or axonemal Dynein heavy, intermediate, light and light-intermediate chains are all components of minus end-directed motors; the complex that transports cellular cargos towards the central region of the cell. Axonemal Dynein motors contain one to three non-identical heavy chains and cause a sliding of microtubules in the axonemes of cilia and flagella in a mechanism necessary for cilia to beat and propel the cell. Cytoplasmic Dynein is an approximately 12 subunit complex of two heavy chains, two intermediate chains to anchor Dynein to its cargo, four smaller intermediate chains and several light chains. It performs functions necessary for cell survival such as organelle transport and centrosome assembly. The carboxy-terminus of Dynein is important for microtubule-dependent motility and is highly conserved, while the amino-terminal regions are more variable. Several proteins regulate Dynein activity, including Dynactin, LIS1 and nudel (nudE-like).

Specifications

• Accession Number: Q13409
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1781
• Name: Human DYNC1I2 (aa 126-174) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110079H08Rik; AW554389; Cytoplasmic dynein 1 intermediate chain 2; cytoplasmic dynein intermediate chain 2; cytoplasmic dynein intermediate chain 2 isoform 2.1; cytoplasmic dynein intermediate chain 2 isoform 2.2; cytoplasmic dynein intermediate chain 2 isoform 2.5; DH IC-2; DIC74; DNCI2; DNCIC2; Dync1i2; dynein cytoplasmic 1 intermediate chain 2; dynein intermediate chain 2, cytosolic; dynein, cytoplasmic 1, intermediate chain 2; dynein, cytoplasmic, intermediate chain 2; dynein, cytoplasmic, intermediate polypeptide 2; IC2; oncofetal protein (OFP); testis tissue sperm-binding protein Li 66 n
• Common Name: DYNC1I2
• Gene Symbol: DYNC1I2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining