missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210174

Invitrogen™ Human DYNC1I1 (aa 135-187) Control Fragment Recombinant Protein

Product Code. 30210174
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210174

Brand: Invitrogen™ RP103419

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63981 (PA5-63981. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14576
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1780
Name Human DYNC1I1 (aa 135-187) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cytoplasmic dynein 1 intermediate chain 1; cytoplasmic dynein intermediate chain 1; cytoplasmic dynein intermediate chain 1 isoform 1.6; DH IC-1; DHIC-1; DIC; Dnci 1; DNCI1; Dncic1; Dync1i1; dynein cytoplasmic 1 intermediate chain 1; dynein intermediate chain 1, cytosolic; Dynein intermediate chain 1, cytosolic (DH IC-1) (Cytoplasmic dynein intermediate chain 1); dynein, cytoplasmic 1, intermediate chain 1; dynein, cytoplasmic, intermediate chain 1; dynein, cytoplasmic, intermediate polypeptide 1; IC74
Common Name DYNC1I1
Gene Symbol DYNC1I1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.