Invitrogen™ Human Dynactin 4 (aa 352-443) Control Fragment Recombinant Protein

Product Code. 30202183

Brand: Invitrogen™ RP102798

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58214 (PA5-58214. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play an role in the regulation of Ins(1,4,5)P3 around the endoplasmic reticulum. Target protein's p62 subunit of the dynactin complex involved in the cytoplasmic dynein motor machinery.

Specifications

• Accession Number: Q9UJW0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51164
• Name: Human Dynactin 4 (aa 352-443) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110001K06Rik; 4930547K17Rik; C130039E17Rik; DCTN4; Dyn4; dynactin 4; dynactin 4 (p62); dynactin 4 (p62) isoform 1; dynactin 4 (p62) isoform 2; dynactin p62 subunit; dynactin subunit 4; Dynactin subunit p62; hypothetical protein LOC550479; P62; si:ch211-174h24.2; zgc:112431
• Common Name: Dynactin 4
• Gene Symbol: DCTN4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: INSTAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPIEESDQGTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining